Quick Answer: What Can I Use Instead Of Just?

What can I use instead of because of?

Synonymsbecause.

conjunction.

used for showing the reason something happens or the reason why it is described in a particular way.due to.

preposition.

because of something.whereas.

conjunction.

owing to.

preposition.

given.

preposition.

in view of something.

phrase.

on account of.

phrase.

for.

preposition.More items….

What words can you not start a sentence with?

Or never begins a sentence, paragraph, or chapter. Never begin a sentence—or a clause—with also. Teach the elimination of but, so, and, because, at the beginning of a sentence. A sentence should not commence with the conjunctions and, for, or however….

How do you say let you know professionally?

The phrase let you know typically refers to the act of informing someone. Here’s a list of synonyms for inform….What is another word for let you know?telladvisebriefenlightenapprisenotifyacquaintinstructedifyupdate157 more rows

What to say instead of I would like to?

What is another word for would like?feel likehanker afterwish forcravedesiredislikefancywantwishyen for140 more rows

How do you not use the word I?

Following General Rules. Use the third person point of view. Never use “I,” “my,” or otherwise refer to yourself in formal academic writing. You should also avoid using the second-person point of view, such as by referring to the reader as “you.” Instead, write directly about your subject matter in the third person.

What can I say instead of just?

What is another word for just?fairhonestgenerouskindhumanefreedevotedaltruisticconsideratereligious224 more rows

How do you write instead of?

We can use instead of in the following ways:instead of + noun. I’ll have tea instead of coffee. instead coffee.instead of + a name. I’ll go instead of Jack. instead Jack.instead of + pronoun you, us, etc. I’ll go instead of him. instead him. instead of + verb + -ing. He went alone instead of waiting for me.

What to say instead of just wanted to let you know?

i just wanted to let you know / synonymsi just want you to know. phr.i just wanted you to know. phr.i want you to know. phr.i just wanted to say. phr.i just want to say. phr.i just want to let you know. phr.just know. phr.i wanted you to know. phr.More items…

Is because a formal word?

Since – This is a formal and secondary equivalent to “because”.

How do you say just letting you know?

just to let you know / synonymsfor your information. phr.just for the record. phr.just so you know. phr.just for your information. phr.for the record. phr.you to know. phr.just fyi. phr.just so you guys know. phr.More items…

What can I use instead of and in a sentence?

Other Conjunctions I like Brian May, yet I find his hair ridiculous. “Yet” can often replace “but” in a sentence without changing anything else, as both are coordinating conjunctions that can introduce a contrast.

Is Since a formal word?

As and since are more formal than because. We usually put a comma before since after the main clause: … We often use as and since clauses at the beginning of the sentence.

Can we start the sentence with because?

The reason you can’t usually start a sentence with “because” is because the sentence needs two parts for because to join together. Usually, “because” goes in between the two clauses, so if we start a sentence with “because” there is often only one clause in the sentence.

What is a good sentence starter?

3. Use Different Words to Order Events and Sequence Timeto be sure… additionally… lastlyeventuallynextfirst… just in the same way… finallyfinallythenbasically… similarly… as well asfirst of allsimultaneouslyafterwardto begin withsoonat firstin the first placewhile4 more rows•Jan 9, 2020

What other words can you use instead of I?

What is another word for I?ayeyesindeedyeayeahrightabsolutelyI concur